SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006995 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006995
Domain Number 1 Region: 492-590
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-20
Family I set domains 0.0082
Further Details:      
 
Domain Number 2 Region: 396-490
Classification Level Classification E-value
Superfamily Immunoglobulin 4.71e-19
Family I set domains 0.0055
Further Details:      
 
Domain Number 3 Region: 294-394
Classification Level Classification E-value
Superfamily Immunoglobulin 3.68e-18
Family I set domains 0.0085
Further Details:      
 
Domain Number 4 Region: 594-682
Classification Level Classification E-value
Superfamily Immunoglobulin 2.65e-17
Family I set domains 0.0059
Further Details:      
 
Domain Number 5 Region: 2-92
Classification Level Classification E-value
Superfamily Immunoglobulin 7.34e-16
Family I set domains 0.0027
Further Details:      
 
Domain Number 6 Region: 194-292
Classification Level Classification E-value
Superfamily Immunoglobulin 8.2e-16
Family I set domains 0.0045
Further Details:      
 
Domain Number 7 Region: 94-192
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000208
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006995   Gene: ENSMODG00000005646   Transcript: ENSMODT00000007135
Sequence length 682
Comment pep:novel chromosome:BROADO5:4:406792831:406818144:-1 gene:ENSMODG00000005646 transcript:ENSMODT00000007135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLPRPTLWALPSPVVYNGTNVTFRCQGPLRSGRFQLWKDGELRDERNASRELAEFELRNV
NGMTDARNYSCRYGQGPLWSDFSEPLALVVTGFFPQPQISTHIHLQVNPGRQVTILCKKL
PSIFSQDYIFVLLEAESLKPLKKKSPTENTVFFTFPSVRIQDSGNYSCIYYKKTAPYIGS
KPSQALKLTVLGKLPKPTLWTQSGLVVIPGTNITFWCSRPKLSFLKEVTFTLWRPWTGKY
LNEQSSGELWTSFLLPSVRPGDTGSYRCTYKEMTASARNSENSDDLKLLVTGSLPKPTLS
ALPGLVVEPGTHVTLQCEHPPSYSSLWGVTFILLKVGISQPLQRQSPGGTSADFLLLSVR
AQDAGSYSCVYHEEMMTLSQVSEPSEVLEIWVTDALPKASLSVRPVPEIASGVNVTLLCQ
GPSRGTGIVLYKEGGKQILPSMYTTQDGAQFSLTHVTPKHSGNYSCGYQPGTEGSLWTQL
SDPLELIVRGSLPKPSLFAFPDLVVKPGVHVTLQCRQPLQSPLWGVTFALLKVGAPQPLQ
SQSPTGTSADFLLLSVRAQDAGNYSCIYSSRTVPYQVSEPSEVLEIWVTDTLYKASLSVW
PDSEVESGTNVTFLCRGPSWSTRFVLYKEREEKILLTMDTTQDGAQWFLIQVTPQNSGNY
RCSYQSGTNESLWEQSSDPLEL
Download sequence
Identical sequences F7BW86
13616.ENSMODP00000006995 ENSMODP00000006995 ENSMODP00000006995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]