SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007036 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007036
Domain Number 1 Region: 25-110
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-20
Family V set domains (antibody variable domain-like) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007036   Gene: ENSMODG00000005675   Transcript: ENSMODT00000007177
Sequence length 111
Comment pep:novel chromosome:BROADO5:1:171163582:171164086:1 gene:ENSMODG00000005675 transcript:ENSMODT00000007177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLLRFSFVLLWLQFAWVSGQKKVEQSPQSLSLHEGENVTMKCNYSFTENSLQWFKQDP
QKGIVSLFVLTREMKKKGRLGASITSKERYSFLHITNFKPEDSGIYLCAVE
Download sequence
Identical sequences F6V4B1
ENSMODP00000007036 ENSMODP00000007036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]