SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007077 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007077
Domain Number 1 Region: 23-112
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-22
Family V set domains (antibody variable domain-like) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007077   Gene: ENSMODG00000005710   Transcript: ENSMODT00000007218
Sequence length 113
Comment pep:novel chromosome:BROADO5:1:171038536:171038945:1 gene:ENSMODG00000005710 transcript:ENSMODT00000007218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRTMTLTILITYYQFEGSYGDSVTQAEGHITLPEGAPFTLNCSYQASRVPYLFWYIQYPN
EALKLLLRETSGKDQENNNNGFWAKKIKEKSSFHLEKNSVQMGDSAVYYCALS
Download sequence
Identical sequences F6U4B6
ENSMODP00000007077 ENSMODP00000007077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]