SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007110 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007110
Domain Number 1 Region: 32-120
Classification Level Classification E-value
Superfamily Immunoglobulin 3.42e-23
Family V set domains (antibody variable domain-like) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007110   Gene: ENSMODG00000005736   Transcript: ENSMODT00000007253
Sequence length 121
Comment pep:novel chromosome:BROADO5:1:170847689:170848215:1 gene:ENSMODG00000005736 transcript:ENSMODT00000007253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIFLSSSLMILWLQLTCEMGIKEGQRSQEQLSQSPHSLSVQERKNVSMHCSYTNVAFNY
FIWYKQDPGKALDLQMDIYSNSAKKENGRMTVLLNKGAKQVSLHIKDAQLGDGGTYFCVA
T
Download sequence
Identical sequences F6QEC4
13616.ENSMODP00000007110 ENSMODP00000007110 ENSMODP00000007110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]