SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007133 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007133
Domain Number 1 Region: 23-114
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-25
Family V set domains (antibody variable domain-like) 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007133   Gene: ENSMODG00000005759   Transcript: ENSMODT00000007277
Sequence length 114
Comment pep:novel chromosome:BROADO5:1:170693618:170694568:1 gene:ENSMODG00000005759 transcript:ENSMODT00000007277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLSGLSFLILWLQLNGVTSQQKVEQSPLFLAVQEGANIIVNCTYTDTTFDYFYWYHQY
SGKGPQLLIKMFSNVVTNHQGRFTIHLDKGAQLFSLLISASQSEDSSTYFCAAS
Download sequence
Identical sequences F6QDB0
13616.ENSMODP00000007133 ENSMODP00000007133 ENSMODP00000007133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]