SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007151 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007151
Domain Number 1 Region: 30-121
Classification Level Classification E-value
Superfamily Immunoglobulin 6.86e-25
Family V set domains (antibody variable domain-like) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007151   Gene: ENSMODG00000005774   Transcript: ENSMODT00000007296
Sequence length 121
Comment pep:novel chromosome:BROADO5:1:170631223:170632143:1 gene:ENSMODG00000005774 transcript:ENSMODT00000007296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLSGLSFLILWLQLNGKLGCWWWVTSQQKVEQSSLSLAVQEGGNAIVNCTYTDTVFNY
FFWYHQYPGKGPQLLLQMFSNMVSNQKGRFAMHLNKGSRFFSLHINTSQSGDSGTHFCAA
S
Download sequence
Identical sequences F6XY90
13616.ENSMODP00000007151 ENSMODP00000007151 ENSMODP00000007151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]