SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007154 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007154
Domain Number 1 Region: 22-115
Classification Level Classification E-value
Superfamily Immunoglobulin 3.33e-22
Family V set domains (antibody variable domain-like) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007154   Gene: ENSMODG00000005778   Transcript: ENSMODT00000007300
Sequence length 117
Comment pep:novel chromosome:BROADO5:1:170570025:170570573:1 gene:ENSMODG00000005778 transcript:ENSMODT00000007300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLQNLLWTVMVSIFLGISTAQKVSQEQSTMTGQEGETVTLNCKYETSATSYTLFWYKQL
LLGEMIFLIRQDSYGQVNTRKDRYLVNLQKTEKFINLTILASQLGDSAMYFCALREP
Download sequence
Identical sequences F6XY67
ENSMODP00000007154 ENSMODP00000007154 13616.ENSMODP00000007154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]