SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007274 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007274
Domain Number 1 Region: 39-258
Classification Level Classification E-value
Superfamily L domain-like 7.56e-35
Family Ngr ectodomain-like 0.015
Further Details:      
 
Domain Number 2 Region: 253-347
Classification Level Classification E-value
Superfamily Immunoglobulin 6.89e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 472-550
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000754
Family Fibronectin type III 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007274   Gene: ENSMODG00000005879   Transcript: ENSMODT00000007422
Sequence length 675
Comment pep:novel chromosome:BROADO5:5:62585337:62614207:1 gene:ENSMODG00000005879 transcript:ENSMODT00000007422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRLACLGLMFSFLAPARSSCPSQCTCGSPSRSDGVGSRLVLCNDPDIHEIPTNVPVDTT
KLRIEKTVIRKIPAEAFYYLVELKYLWVTYNSVATIDTGGFYNLKHLHELCLDGNLLTAF
PWESLLEMPNLRTLDLHNNRITSVPAEATRYLKNLTYLDISSNRLTTLPPDLLDTWPHFS
ADLGPRGMGLPPSRIILGLQDNPWFCDCHISKVMELSKTVDPTVVLLDPLLICSGPQSLM
GISFQRAELEQCLKPSVMTSATKITSALGSNVLLRCDATGHPTPQLIWTRTDNLPVNSTV
IQETPGDGIRWSIISLTGISYKDAGDYSCKAKNLAGTSEAIVSVTVVGIVATTVSPQMSG
KRDGTHQPLEESKDAAEKSTLMTTSPSPPSTFSSFPSSSLSFSSLSSASTSPIITSTTIP
ITTEISANTKMTSRKPPKSFPIGKKNSKVVISGSKLPPASASKKEISLLSTAAITEPGTI
IKNLKVVNETHESVTLTWKAVNPTKNTAITVLYSKYGEEDMVPLSTDSRESQITIDGLEA
GMQYVACVCPKGAPPKTDQCITFSTDRINEKTNSQISFLILTSSAACVVVLPLIFYLFYK
VLRLQCKPKAIREDDLARETYIQFDTLSPKPHPSRELWTRRRADESERLLLLCSQSSVDS
PATFKNKGSRSEYYC
Download sequence
Identical sequences F6SN91
ENSMODP00000007274 XP_007496058.1.35504 ENSMODP00000007274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]