SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000007977 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000007977
Domain Number 1 Region: 4-267
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.09e-74
Family Eukaryotic proteases 0.0000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000007977   Gene: ENSMODG00000006426   Transcript: ENSMODT00000008140
Sequence length 275
Comment pep:novel chromosome:BROADO5:3:459405433:459413589:1 gene:ENSMODG00000006426 transcript:ENSMODT00000008140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALSLLFPMDPQGWLLTGILTFFLGCGGLPGCKSGRIIGGREVKPHSRPYMASVRFMGH
HHCGGVLFMAQWVMTAAHCFFNKNSSLSLIVLGAHSTNNPEPTQQTFTIQQSILHPGYDP
QTHQNDLCLLKLDHKATLSSSVGLVKLPRAGVDPKHGTRCLVSGWGSLSDFGHPSPGLME
ADVSVLDRRTCNSSWKGQVSSKMLCAISGKWKRVGFCTADSGGPLICGTQALGIVSFSGT
WCGDPKTPDVYTLISAFITWIRSVTQKSTLTPFPS
Download sequence
Identical sequences F7EZH8
XP_007489487.1.35504 ENSMODP00000007977 ENSMODP00000007977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]