SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008073 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008073
Domain Number 1 Region: 18-249
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.54e-78
Family Eukaryotic proteases 0.0000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008073   Gene: ENSMODG00000006506   Transcript: ENSMODT00000008237
Sequence length 250
Comment pep:novel chromosome:BROADO5:4:397534742:397547567:1 gene:ENSMODG00000006506 transcript:ENSMODT00000008237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFPLTLDLISISLGQGWTDTRAIGAEECTPNSQPWQAGLFFLTRLFCGATLLNDQWLLTA
AHCRKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNSDLSAHDHNHDIMLIRLKRPA
KLGPAVQPLNISNNCVRPGTTCLISGWGATSSPEVEYPLSLQCANISVLDPRLCHKAYPG
RITSNMVCAGLWEGGRGSCQGDSGGPLVCNGALAGVVSGGAEPCSKPKRPSVYTSVCQYR
KWISKTMREN
Download sequence
Identical sequences F7EK12
13616.ENSMODP00000008073 ENSMODP00000008073 ENSMODP00000008073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]