SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008086 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008086
Domain Number 1 Region: 100-205
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000199
Family V set domains (antibody variable domain-like) 0.091
Further Details:      
 
Domain Number 2 Region: 36-133
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000138
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008086   Gene: ENSMODG00000006517   Transcript: ENSMODT00000008250
Sequence length 275
Comment pep:novel chromosome:BROADO5:3:459648559:459682084:-1 gene:ENSMODG00000006517 transcript:ENSMODT00000008250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPLLWLLAAVLLCARAASGTGNNIWTAIDVSSHRTLLTCKLKEAISAPIEGHRWLKGD
KVLKEDKSDSLTTEYEVVSDDRSGEYQCIFLPELAGKADVQVKGPPKVYINKKSEYGNEG
DSIVLTCKSSSYPSIEQWKWYKENEGEANMILVNDTEGRMSIISTPEKTELHINSADIKE
DPGKYICNGTNSEGSDTAVITLKVRSRLAALWPFLGIVAEVLILVIIIFIYERRRRTDDI
VEAEPPRDEDGGAAPLKASSAVNEKGSNIRQRNSN
Download sequence
Identical sequences F7E424
ENSMODP00000008086 XP_007489489.1.35504 ENSMODP00000008086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]