SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008100 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008100
Domain Number 1 Region: 19-197
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.5e-68
Family MHC antigen-recognition domain 0.00000706
Further Details:      
 
Domain Number 2 Region: 206-282
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-24
Family C1 set domains (antibody constant domain-like) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008100   Gene: ENSMODG00000006527   Transcript: ENSMODT00000008264
Sequence length 340
Comment pep:novel chromosome:BROADO5:2:75213829:75243750:1 gene:ENSMODG00000006527 transcript:ENSMODT00000008264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFLFHLLMTSATQGGDARTHSLRYFRLGLSDSNQGMPEFISVGYVDSHPITSYDSNGRQ
KMPQASWMEENLGSDHWEKYTQLLRGWQQTFKIELRALQNHYNHTGGFHIYQRMIGCELL
EDGSTTGFLQYAYDGKDFIVFNKESLSWIAMDNVARLTKQAWEANRNELRYQKNWLETEC
IAWLKKFLDFGKDTLQRTETPLLSGSCKKSSTGITTLICKAYGFYPPEITMTWIKNGELI
TQEIEHGDILPSGDGTYQTWVSIDIDPQSKDHYSCQVEHNNFLKVLHVPVELKTISLSPY
VEIVSGVIIIASFLIGLGIFVYKRKQSELKEVGYVPTPVK
Download sequence
Identical sequences F7CDQ3
NP_001278598.1.35504 ENSMODP00000008100 ENSMODP00000008100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]