SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008108 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008108
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily SEA domain 5.36e-20
Family SEA domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008108   Gene: ENSMODG00000006530   Transcript: ENSMODT00000008272
Sequence length 169
Comment pep:novel chromosome:BROADO5:3:462470063:462475287:-1 gene:ENSMODG00000006530 transcript:ENSMODT00000008272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYTAKMNQKDSRTSKAAEHILQILLKVLFGSSRLGSQYSGCSDLSLRSLRNRIATGVDI
LCTFKKDSSNHVLDKKVVYWELTEQLCTRKLKHLVIDNDSLIVNGSIKSKTHKDMKQELE
RAGETHSQVSGSEAGVGAVTHIPDHGEPGKIMTSLTSGLLIRESTVYAI
Download sequence
Identical sequences F7CDM1
ENSMODP00000008108 ENSMODP00000008108 13616.ENSMODP00000008108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]