SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008146 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008146
Domain Number 1 Region: 130-249
Classification Level Classification E-value
Superfamily Immunoglobulin 2.87e-43
Family I set domains 0.0014
Further Details:      
 
Domain Number 2 Region: 45-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000729
Family I set domains 0.00058
Further Details:      
 
Domain Number 3 Region: 281-353
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000194
Family I set domains 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008146   Gene: ENSMODG00000006567   Transcript: ENSMODT00000008310
Sequence length 409
Comment pep:novel chromosome:BROADO5:3:459816212:459821167:-1 gene:ENSMODG00000006567 transcript:ENSMODT00000008310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEAALPFPLYLLFLFRRELFLFFLLVLLQGQSSWAAPRDGENPVQVEPKWPVVPAGGSI
QLRCSVACPGNEATVQWKGLDTSLGHVFSEPGLSVLTIPEATLSMAGTKVCISTCQGQTY
QDRVELLVYAFPDKLEVSPSTLVLGQAATLVCSAREVSPYDSRLTFAWYQGDEKLGELEL
LYEDLKPEQEAETGEDLEVFQVTKHWALPAELVTLGPELRCQVEMKLEHQVLSHSRGIAE
APVVQDYTSTLPDTTASSLTLGHGSSLSPTSKSSTGYLCLPKISWSQTSGIHGGHLVLTC
KTACEPGASVSWSQAPGSLADYQRQEAGAQATLIIMHPGPQNRGLYQCQQEPGGQTARIS
LDRNIVPDVDKWGNSAALWTGGCMLGLILMAFVSYRLRRWLRTKACASL
Download sequence
Identical sequences F7BUG9
ENSMODP00000008146 ENSMODP00000008146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]