SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008151 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008151
Domain Number 1 Region: 34-212
Classification Level Classification E-value
Superfamily vWA-like 1.48e-41
Family Integrin A (or I) domain 0.00038
Further Details:      
 
Domain Number 2 Region: 216-382
Classification Level Classification E-value
Superfamily Fibronectin type III 9.23e-19
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 334-475
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000324
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008151   Gene: ENSMODG00000006572   Transcript: ENSMODT00000008316
Sequence length 495
Comment pep:novel chromosome:BROADO5:2:103456946:103472316:1 gene:ENSMODG00000006572 transcript:ENSMODT00000008316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMWAALGLLCLPLALGQSIPEPGPATPSSAAHGDLLFLLDSSASVSYYEFSRVKEFVGQ
LVQPLPLGPGSVQTSMVHVGSEPTVEFPFDRHHSGAAAQEAIQAAKQLMGDTNTGLALAL
AKKQLFTTEAGARSGVRKVLVWVTDGDSSDDVQAPMQVLKDLGVTVFIVSTGRGNFLDLS
AAASQPPEKHLRFVDVDDLQIIIPELRGAILEAMRPQQLHATDVTSQSFRLVWPPLLSGD
SGYYLLEVAPSANPGAKQSRQLFGNETSWVWDGLEPGTTYKVVLVPESNLQYLAPQTIQV
TTLEEEVSPAQILISHWKPHSFHVSWGPSPVGVLRYQVLYGPLPAGGAQLLEVPATENST
TLDNLSPNTTYLVTVAAIYQSGREKALSAKACTQEVASKTGRLYFQSLGPSTVNASWDSA
EGDVRGYRVRCRRQLGPPSLLSVSPQTHSVILTGLAAGTTNHVCVTPIYPSHPGPRRCQT
VRMHPVTPAPEYRPT
Download sequence
Identical sequences F7B879
ENSMODP00000008151 ENSMODP00000008151 XP_007481146.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]