SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008278 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008278
Domain Number 1 Region: 1180-1374
Classification Level Classification E-value
Superfamily Fibronectin type III 1.89e-39
Family Fibronectin type III 0.00000122
Further Details:      
 
Domain Number 2 Region: 568-770
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-38
Family Fibronectin type III 0.00000587
Further Details:      
 
Domain Number 3 Region: 1377-1583
Classification Level Classification E-value
Superfamily Fibronectin type III 2.83e-37
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 4 Region: 971-1178
Classification Level Classification E-value
Superfamily Fibronectin type III 6.09e-37
Family Fibronectin type III 0.00000371
Further Details:      
 
Domain Number 5 Region: 770-961
Classification Level Classification E-value
Superfamily Fibronectin type III 6.82e-34
Family Fibronectin type III 0.00000239
Further Details:      
 
Domain Number 6 Region: 1683-1879
Classification Level Classification E-value
Superfamily Fibronectin type III 3.6e-32
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 7 Region: 1539-1684
Classification Level Classification E-value
Superfamily Fibronectin type III 2.74e-27
Family Fibronectin type III 0.0006
Further Details:      
 
Domain Number 8 Region: 4-70,114-182
Classification Level Classification E-value
Superfamily Immunoglobulin 1.94e-21
Family V set domains (antibody variable domain-like) 0.085
Further Details:      
 
Domain Number 9 Region: 383-481
Classification Level Classification E-value
Superfamily Immunoglobulin 2.46e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 10 Region: 279-377
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 11 Region: 476-574
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-17
Family I set domains 0.039
Further Details:      
 
Domain Number 12 Region: 193-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000375
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008278   Gene: ENSMODG00000006665   Transcript: ENSMODT00000008444
Sequence length 2132
Comment pep:novel chromosome:BROADO5:2:216970272:217220511:1 gene:ENSMODG00000006665 transcript:ENSMODT00000008444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDVSPYFKTEPVRTQVHLEGNRLVLTCMAEGSWPLEFKWLHNNRELTKFSLEYRYMITSL
DRTHAGFYRCIVRNRMGALLQRQTEVQVAYMGSFEEGEKHQSVSHGEAAVIKAPRISSFP
QPQVTWFRDGRKIPPSSRIAITLDNTLVILSTVAPDAGRYYVQAVNDKNGDNKTSQPITL
TVENVGGPADPIAPTIIIPPKNTSVVAGTSEVTMECVANARPLIKLHIIWKKDGVPVSGG
VSDHNRRLTILNPKGSNTGYYECEAVLRSSSVPSVVRGAVLSVLEPPQFIKEPERHITAE
MEKVVDIPCQAKGVPSPITTWYKDAAVIDVKKLSRFRLHGDGSLQISGLVPDDTGMFQCF
ARNSAGEVQTSTYLAVTSIAPNITRGPLDSTVIDGMSVVLACETSGAPRPAITWQKGERI
LASGSIQLPRFTLLESGSLLISPTRISDAGSYTCLATNSRGVDEASADLVVWARTRITMA
PQDQSVIKGTKAFMTCGVTHDPSVSVRYVWEKDGAILGVDSTPRMRLDKNGSLHISQTWS
GDIGTYTCRVLSAGGNDSRSAYLRVRQLPHAPEHPVATLSTAERRSINLTWAKPFDGNSP
LIHYVLEMSENNAPWTVLLPNVDPEATSVMVKGLVPARSYQFRLCAVNDVGKGQFSKDTE
RVSLPEEPPTAPPQNVIASGRTNQSIMIQWQPPPESHQNGILKGYIIRFCLAGLPVGYQF
RNITNADVNNLLLEELIIWTNYEISVAAYNSAGLGVYSSKVTEWTLQGVPTVPPGNVRAE
AINSTTIRFTWNAPSPQFINGINQGYKLIAWEPEQEEEVTMVTARPNFQDSIHVGFVSGL
KKFTEYFTSVLCFTTPGDGPRSLPQLVRTHEDVPGPVGHLSFNEILDTSLKVSWQEPGER
NGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSA
STISSGVPPELPGPPTNLGISNIGPRSVTLQFRPGYDGKTSISRWLVEAQVGVVGEGEEW
LLVHQLANEPDARSMEVPNLNPYTFYSFRMRQVNIVGTSPPSQPSRKIQTLQAPPDMAPG
NVTLRTASETSLWLRWMPLPEMEYNGNPESVGYKIKYTRSDGHGKTLSHVVHDRIEREYT
IEDLEEWTEYRVQVQAFNAIGTGPWSQIVVGRTRESVPSSGPTNVSALATTSSSMLVRWN
EIPEADRNGLVLGYKVVYKEKDSDTQPQFWLVEGNSSLSAQLTGLGRYVLYEIQVLAFTR
IGDGTPSSPPILERTLDDVPGPPMGILFPEVRPTSVRLIWQPPAAPNGIILAYQITHRLN
TTTANTASVEVLTPSARQYTATGLKPESIYLFRIMAQTRKGWGEAAEALVVTTEKRDRPQ
PPSKPVINQENVKARSVLLSWEPGSDGLSPVRYYTIQTRELPSGKWALHSSSVTHNATSF
VVDRLKPFTSYKFRVKSTNDIGDSEYSEESESLTTLQAAPEEAPTILSVTPHTTTSVLIS
WQPPAEDKINGILLGFRIRYRELLYEGLRGFTMRNINNPSTKWAELTYLSKHKRYEIRMS
VYNAVGEGPSSSPQEVFVGEAVPTAPPQNVAVHGATATQLDVTWEPPPLEAQNGDIQGYK
IYFWEAQRRNSTERLKTLFLPENGVKLKNLTGYTAYLVSVAAFNAAGDGPRSAPSQGRTQ
QAAPSAPSTVKFSELTTTSVNVSWEPPLFPNGVLEGYKLIREPDTEREGVSKIVTVDVKG
NSPLWLKVKDLSEGMTYRFRIRAKTFTYGPEIEANITTGPGEGAPGPPGIPIIIRYSSAI
AIHWSSGDPGKGPITRYVIEARPSDEGLWDILIKDIPKEVTSYTFSMDILKHGVSYDFRV
IAVNDYGYGTPSSPSQSVPAQKANPFYEEWWFLVVIALVGLIFILLLVFVLIIRGQSKKY
AKKSDSGNNAKSSALGHGEMVSLDESSFPALELNNRRLSVKNSFCRKNGIYTRSPPRPSP
GSLHYSDEDVTKYNDLIPAESSSLTEKPSEISDSQGSDSEYEVDQNHQKAHSFVNHYISD
PTYYNSWRRQQKGISRAQAYSYTESDSGEPDHSTVANNNSTQQGSLFRPKASRTPTPQNP
ANPPSQQSTLYRPPSSLAPGSRAPIAGFSSFV
Download sequence
Identical sequences F7FFV4
ENSMODP00000008278 ENSMODP00000008278 13616.ENSMODP00000008278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]