SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008322 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008322
Domain Number 1 Region: 116-211
Classification Level Classification E-value
Superfamily Immunoglobulin 3.28e-20
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 27-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000243
Family I set domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008322   Gene: ENSMODG00000006712   Transcript: ENSMODT00000008488
Sequence length 305
Comment pep:novel chromosome:BROADO5:Un:30212587:30217098:1 gene:ENSMODG00000006712 transcript:ENSMODT00000008488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPIVASLIWLGECLGPGWAGGEEGTPKPFIWVEPGSVVPREAHVRFCCRSPWRSGSFQL
WKDGSCSFQINSSREQADVCFPNSVAAAGSYSCRYSRGLHWSELSAPLELLVTGHFSQPS
LCGAPSTVVSAGDTVTLLCQALSSYYKPKLTFFLLKAGVPHPVQRQSPEGHEANFTLPSV
KAEDAGSYSCIYSVGGRASSPSDALHLEVTGARRALGIPPPPFPPVKGFSHRNPPLSSMT
YKSFSLVFRWKGRTSPQARLIHSQCLSSSSAQDYTVGNTVRIALAGLVLIILGVFLAEAW
HSQQR
Download sequence
Identical sequences H9H678
ENSMODP00000008322 13616.ENSMODP00000008322 ENSMODP00000008322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]