SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008326 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008326
Domain Number 1 Region: 86-182
Classification Level Classification E-value
Superfamily Immunoglobulin 3.9e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000707
Family I set domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008326   Gene: ENSMODG00000013155   Transcript: ENSMODT00000008492
Sequence length 224
Comment pep:novel chromosome:BROADO5:Un:68445656:68447143:1 gene:ENSMODG00000013155 transcript:ENSMODT00000008492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKPLIWVEPGSVVPREAHIHFCCRSPWRSGSFQLWRDGGCLFQINASREQADVCFPKSLA
AAGSYSCRYSQGLHWSELSAPLQLLVTGHFSKPSLRGAPSTVVAARDTVTFLCQALRSYH
NPKFMFSLLKAGVPHPVQHQSPEGDVANFTLPSVKAEDAGNYSCIYSVGERSSSPSDALQ
LKCLSSSSAQDYTVGNIVRIALAGLVLIILGVFLAEAWHSQQRS
Download sequence
Identical sequences H9H680
ENSMODP00000008326 ENSMODP00000008326 13616.ENSMODP00000008326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]