SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008329 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008329
Domain Number 1 Region: 139-234
Classification Level Classification E-value
Superfamily Immunoglobulin 6.1e-20
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 50-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000112
Family I set domains 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008329   Gene: ENSMODG00000028611   Transcript: ENSMODT00000008495
Sequence length 260
Comment pep:novel chromosome:BROADO5:Un:89307668:89309686:1 gene:ENSMODG00000028611 transcript:ENSMODT00000008495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMSPTVASLLWLGLCLAQIAAAGAQSLPSVGSCPSSSSEQKGTSMAGTPKPFIRAVPGS
VVPREAHVHFCCRSPWRSGSFQRWKDGGCSRQINTSREQAEGCFPTLLAAPGRYSCLSSR
GLHWSELSDPLQLLVTGHFSKPSLRGAPSTVVAAGDTVTLLCQASPTYHNPKFTFSLLKA
GVPHPVQRQSPEGHEANFTLPSVKAEDAGSYSCIDSVEGRASSPSDALHLEVTGARRALR
IPPPPFPPVCGAGGGAWMIK
Download sequence
Identical sequences H9H681
ENSMODP00000008329 ENSMODP00000008329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]