SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008350 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008350
Domain Number 1 Region: 78-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.15e-38
Family Matrix metalloproteases, catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 313-377
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000151
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008350   Gene: ENSMODG00000006736   Transcript: ENSMODT00000008517
Sequence length 394
Comment pep:novel chromosome:BROADO5:2:103771506:103780342:1 gene:ENSMODG00000006736 transcript:ENSMODT00000008517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGVNPPAEPPGGTARMPSYRALLGLLCLLPALALLLTLKDTADPEARGSQEDVSLPGP
DSLRGTQAPRERLLPPKARRKRYTITPSRLHWDHFNLTYKILSYPRNLINQSETRRGLGA
AFRMWSSVSPFTFREVAPALPSDLKIGFYPINHTDCLRSVVHRCFDGTTGELAHAFFPPN
GEIHFDDSEYWIVGETRFSWKKGVWLTDLVHIAAHEIGHALGLMHSLNPNALMHINATLT
GKKVISQDEMWGMHRLYGCLDRLSVCPSWARRGFCDTRQKFMKKLCPHSCDFCYEFPFPT
VAATPPPPRTKTKLVAEGRNVTFRCGQKIVHKKGKVYWYKDRELLEYSYPGYLDLNEGHM
SIIVNAINEGTYTCVVKKRDRVLTTYSWRIRVNY
Download sequence
Identical sequences F7CDE4
13616.ENSMODP00000008350 XP_007481153.1.35504 ENSMODP00000008350 ENSMODP00000008350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]