SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008369 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008369
Domain Number 1 Region: 828-936
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-23
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 310-435
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-19
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 27-163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.34e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 272-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000137
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 159-309
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000267
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 706-825
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000157
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 7 Region: 645-747
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000576
Family Growth factor receptor domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008369   Gene: ENSMODG00000006256   Transcript: ENSMODT00000008536
Sequence length 1014
Comment pep:novel chromosome:BROADO5:8:16519410:16732231:-1 gene:ENSMODG00000006256 transcript:ENSMODT00000008536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAALPWHWCLLLVLGAPGRLTRATGAPDTDECAEGTDDCHIDAICQNTPKAYKCLCKP
GYKGEGRQCEDIDECENDYYNGGCVHECINIPGNYRCTCYDGFMLAHDGHNCLDVDECLD
NNGGCQQICVNTMGSYECQCREGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKG
GVACECRPGFELAKNQRDCTLTCNYGNGGCQHTCDDTDTGPVCGCHQKYALHSDGRTCIE
KDEAAIESTEFNTTSVADVDKRVKRRLLMETCAVNNGGCDRTCKDTATGVRCSCPVGFTL
QPDGKTCKDIDECLVNSGGCDHFCRNTVGSFECSCQKGYKLLTDERTCQDIDECSFERTC
DHTCINYPGSFECLCHRGYTLYGLTHCGDVDECSINNGSCDYGCINTLGSYECACPAGRK
LHWNKKDCVETVKCLPGAKAAPKIQLACSRTGGLETCFLACPSNTLFIPDSENSYSLSCG
IPGQQGKSPQKRNSTVPSFPSCTDPLLPPIKQKARFKIRDAKCHLQRRSKDKVKEVGKQA
LLDNCQVTFVNLQCDSSKKKRRGRKSPSKEVSHITAEFEVEMKSEEVSETCNPDCVRKRL
EQKLQAAIKTLRKSINKQQFYLQFSGTEYEVAQKPAKTAEGQEACGPGLALLDGKCVACG
PGTYYSGEHSKCLPCLPGTYQDTEGQLTCEPCPSNDGQGLAGARNVSECGGQCSPGFYSS
DGFKPCRPCPLGTYQPEPGRTLCFPCGGGLVTKYEGAVSFQDCETKVHCSPGHYYNSSTH
RCIRCPIGTYQPEFGQNYCITCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYIESPNY
PGDYPANVECIWNINPPPKRRILIVVPEIFLPIEDECGDVLVMRKSASPTSITTYETCQT
YERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQ
EILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences F7CCK4
XP_007502848.1.35504 ENSMODP00000008369 ENSMODP00000008369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]