SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008383 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008383
Domain Number 1 Region: 1109-1192
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-20
Family I set domains 0.0081
Further Details:      
 
Domain Number 2 Region: 1197-1286
Classification Level Classification E-value
Superfamily Immunoglobulin 5.59e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 812-868
Classification Level Classification E-value
Superfamily BPTI-like 1.18e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 
Domain Number 4 Region: 976-1055
Classification Level Classification E-value
Superfamily Immunoglobulin 3.37e-17
Family V set domains (antibody variable domain-like) 0.064
Further Details:      
 
Domain Number 5 Region: 345-400
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000157
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 6 Region: 65-119
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000876
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 7 Region: 542-604
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000068
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 8 Region: 427-486
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000012
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 485-542
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008383   Gene: ENSMODG00000006768   Transcript: ENSMODT00000008551
Sequence length 1339
Comment pep:novel chromosome:BROADO5:1:250881826:250973847:-1 gene:ENSMODG00000006768 transcript:ENSMODT00000008551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGFNLGVGSCLIPLFTTLYPWKALDLLEPFSPVQKMKTHLLLLMLLLLLPPLPVSSAR
KVRRQNENWGHWGEWSQCSRTCGGGVSFQERHCYSQRIDGSSSCIGPTRNYRSCNTESCP
QGTRDFRAEQCAEFDGKEFQGKKYKWFPYYGAANKCELNCIPKGENFYYRHKEAVVDGTP
CEPGKLDICVQGTCQAVGCDHVLYSSKKEDKCLRCGGDGQTCYPVKGTFDANDLTKGYNQ
ILIIPAGATSIHIAEVTASRNFLAVKNVRGEYYLNGHWTIEFGRALPVASTILQYERGSE
GDLAPEHLRARGPTSEPLVIELISQEPNPGVQYEYYLPHWPLDTGFTWSHGSWSDCSAEC
GGGYQTRLVFCTTINEVYPDHMCRHKPQPSDNRTCNLQACPQTKRISYLHRPGVWSHGQA
RGMCGKSWKTGPWTACSAPCGGGSQSRHVYCVVSDGAGMEEATDEASCSALPGRPPSTQS
CNLHRCAAWSSGPWGECSASCGPGVRSRTVTCWGDEGSALQDFACSSADKPPLTEACMGE
NCPLQEPGWHIGDWGLCSKSCDSGIRKRQVICADRDSNVYSSDLCQARQPQMPAEVEACN
TQSCHLPQEVPSMQDVQGYDTSRQDPLETPSQGGREEWWLHRNQPPSEHSREGHGGSNLL
PQHQESGWRSSGSRQYHQQRDPVSRPQPPDCRHSLHGCCPDGHTVAPGPLGRGCPRISCQ
QSTYGCCPDGVSSALGRNHAGCPRSHDETHVNRHGPRAASSPARRKGTSQPAESRPDPSV
ECRGSRYGCCYDNSASSTGPLGEGCQGRPSSPYPVRCLLPSAHGSCADWTPRWYFIPTVG
KCNRFWYGGCHGNRNNFLSEEECMKSCHEGAEDSPSRNDDQSRTGESWGLDHTGTSQGSP
SLSASTSRLEQGGQALRPEKTQLSRTFEQEISKSQHTGHQDREDRPSVFVPREDSRQPAP
HSQVPSHRIVLDRTEYSGVQVTLGQMVRFFCVAGASPDVKWQKNGKPVRSSNRYHLQLDG
SLAISSVSEEDAGTYTCSTSVGGQDSSRQVQLWITGDDREAPAEAERNLPPIQDHKHLDF
GMGGGRPGHRPSSPRHRQPGPRLSFDRNQPGVVDANIGQRVQLPCRTSGYPPPVIEWQKD
GQPLSSPRHQQQPDGSLLISRVSREDGGFYTCIAFNQREREQRWVQLRILGRELKIVGLE
PAVTVPEGGDTELHCVVLGDDVNVRWSRNGVPLRGDGYRIHLSQDGTLVINNTRARDEGS
YTCSAYSGSQAVSRSTEVKVVYPRPPEQPRDPSRECIDQPELANCDLILQAQLCGNEYYS
SFCCASCSRYQPQARPVWQ
Download sequence
Identical sequences F7BTW4
ENSMODP00000008383 ENSMODP00000008383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]