SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008412 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008412
Domain Number 1 Region: 91-172
Classification Level Classification E-value
Superfamily Immunoglobulin 7.15e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 12-101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000182
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008412   Gene: ENSMODG00000028082   Transcript: ENSMODT00000008580
Sequence length 204
Comment pep:novel chromosome:BROADO5:Un:78196976:78397786:-1 gene:ENSMODG00000028082 transcript:ENSMODT00000008580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYAPLSKPTILTSNNTAVETKDFSLTCNATGQIHAYKWFINGVAPAGLRIQLSPDRRTL
TLRSLTRSDNKGPYVCEIENPFYRNRSDPFTLDVAYGPDIATIVHSPDEYPTGANITLSC
VADSNPAAQFTWLHNGQPVSNSATFSIIASLSDAGTYTCTASNSFTGLTRTATKNIIIYG
EYLDWAPNFVWGSLFPWHDRNRQK
Download sequence
Identical sequences M9MMH1
ENSMODP00000008412 ENSMODP00000008412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]