SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008416 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008416
Domain Number 1 Region: 93-186
Classification Level Classification E-value
Superfamily Immunoglobulin 8.93e-16
Family I set domains 0.005
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000181
Family I set domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008416   Gene: ENSMODG00000006799   Transcript: ENSMODT00000008584
Sequence length 187
Comment pep:novel chromosome:BROADO5:Un:30306352:30310363:1 gene:ENSMODG00000006799 transcript:ENSMODT00000008584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSLEAWPKTPVPLGGNLVLHCKGGHERGLYRLYREAVEEPVAFEDSCQESWSSLFMYSNV
STAHTGRFRCHYSFHSFWSKLSDPLDVPVSDLYEKPSLWVVPGLIVPTGKNFTLYCRSEV
GLDRFVLYHDFLEEGFETILPEKIQKNKATFSFFNKTDAMDGSYQCFGFMSSEPFYWSNS
SDILMLS
Download sequence
Identical sequences H9H686
13616.ENSMODP00000008416 ENSMODP00000008416 ENSMODP00000008416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]