SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008467 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008467
Domain Number 1 Region: 28-135
Classification Level Classification E-value
Superfamily Immunoglobulin 8.8e-19
Family V set domains (antibody variable domain-like) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008467   Gene: ENSMODG00000006834   Transcript: ENSMODT00000008635
Sequence length 291
Comment pep:novel chromosome:BROADO5:2:214952068:214963349:1 gene:ENSMODG00000006834 transcript:ENSMODT00000008635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMRYEKKMYLLSTFLFLWLSGCFSDGQLWSPKHVNFEENSLGTINCSYAKKWETYVKWW
CRGFYWSCTILVKTKESESVKDRVSIQDDKAAHTFTVTIKDVRKEDEDFYWCGIEKFGTD
IGNQIKLTVSSAPTTGKTTTDLGFPFFSSRFKITDLQHLLPIIFGILLMFVAVSILVWRM
MLRQKKERPVRGKKKEELLQTTEEGICYAHLTLQQRTFRDTHLDFPEEEASPKASNRVNS
SYNEVEYVTMASLRGENISYDTLSLDMPDQNSIYSNMGNLNSQHHLRNPVE
Download sequence
Identical sequences F6PG36
ENSMODP00000008467 ENSMODP00000008467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]