SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008535 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008535
Domain Number 1 Region: 84-251
Classification Level Classification E-value
Superfamily PR-1-like 3.53e-52
Family PR-1-like 0.00013
Further Details:      
 
Domain Number 2 Region: 320-418
Classification Level Classification E-value
Superfamily LCCL domain 2.22e-30
Family LCCL domain 0.0011
Further Details:      
 
Domain Number 3 Region: 422-526
Classification Level Classification E-value
Superfamily LCCL domain 2.88e-28
Family LCCL domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008535   Gene: ENSMODG00000006887   Transcript: ENSMODT00000008703
Sequence length 531
Comment pep:novel chromosome:BROADO5:3:161061551:161254937:-1 gene:ENSMODG00000006887 transcript:ENSMODT00000008703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQMFSLKRQGVEGRLYLGVYPRGILKSFMMKCAAQEWLRITALLFIANTIPAMIVPNAT
VLEKLLEKYMDEDGEWWIAKQRGKRAITDNDMQSILDLHNKLRSQVYPPASNMEYMTWDV
ELERSAESWAETCLWEHGPASLLPSIGQNLGAHWGRYRPPTFHVQAWYDEVRDFTYPYPH
ECNPYCPFRCSGPVCTHYTQVVWATSSRIGCAINLCHNMNIWGQIWPKAVYLVCNYSPKG
NWWGHAPYKHGRPCSACPPSFGGSCRENLCYKEGSERHFSPREPEETNEIERQQSQVYDP
QIQTRADDSNRNEVISTQQMSQIVACEVRLRDQCKGTTCNRYECPAGCLDSKAKVIGSVH
YEMQSSICRAAIHYGIIDNDGGWVDITRQGRKHYFIKSYRNGIQSIGKYQSANSFTVSKV
TVQAITCETTVEQLCPFHKPASHCPRVYCPRNCMQANPHYARVIGTRIYSDVSSICRAAV
HAGVVRNQGGYVDVMPVDKRKVYIASFQNGIFSESLQNPPGGKAFRVFAVV
Download sequence
Identical sequences F6PVR0
ENSMODP00000008535 ENSMODP00000008535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]