SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008599 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000008599
Domain Number - Region: 293-342
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0211
Family Fibronectin type III 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008599   Gene: ENSMODG00000006938   Transcript: ENSMODT00000008769
Sequence length 450
Comment pep:novel chromosome:BROADO5:Un:49417111:49443484:1 gene:ENSMODG00000006938 transcript:ENSMODT00000008769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CNPPLGGMKTSPTDNAQNNGLIDAFSALSSGNGAITQRSIQLESKGVTLTNEDWMNGTVI
FDSTVGNDTLFLVTWTAQQPEMFVMDPSGNIYKNFTVKASSKMAYLQIPNTAQVGIWTYS
LKSSAQTLTLTVTSRAANPNVSPITVDSRMNTDNSSYPSPMIVYAEVRQGSLPIIGANVT
ALIESADGTTVTLELLDNGAGADVFKNDGVYSRYFTAFNQNGRYSLKVRALGGTNTQRSR
PKVNGAFYIPGWVENGEIKMNPPKPEISEDENQANMQSFSRTSSGGSFIVSNIPPTVPDV
FPPNRIIDLEANVEDDHINLTWTAPGDDFDTGRAEEYIIKMSKDILTLRENFDAALQVNT
TDLIPNDANSKEDFMFKPDFLIENGTTVFLAIKAVDKANLTSPISNIAQASLIIPSPEDP
FSPSGTSISTIVLSVVGTVAAVAIIVSVTV
Download sequence
Identical sequences H9H690
ENSMODP00000008599 13616.ENSMODP00000008599 ENSMODP00000008599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]