SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Monodelphis domestica 69_5 > ENSMODP00000008678

Domain assignment for ENSMODP00000008678 from Monodelphis domestica 69_5

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSMODP00000008678
Domain Number 1 Region: 237-307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.62e-16
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 2 Region: 32-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.00066
Further Details:      
 
Domain Number 3 Region: 296-365
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.00074
Further Details:      
 
Domain Number 4 Region: 543-612
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.00074
Further Details:      
 
Domain Number 5 Region: 736-805
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 6 Region: 374-436
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 7 Region: 431-489
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000848
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 8 Region: 618-677
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000133
Family Complement control module/SCR domain 0.00062
Further Details:      
 
Domain Number 9 Region: 107-166
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.00068
Further Details:      
 
Domain Number 10 Region: 811-870
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.00068
Further Details:      
 
Domain Number 11 Region: 698-747
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 12 Region: 172-230
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 13 Region: 877-934
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008678   Gene: ENSMODG00000006999   Transcript: ENSMODT00000008849
Sequence length 934
Comment pep:novel chromosome:BROADO5:Un:76789549:76798767:-1 gene:ENSMODG00000006999 transcript:ENSMODT00000008849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
LLWLEVGIRIMSKVFQRTFWQYPLLLSFFIEVICPPPPKIENGKYTGSSADEVPYGTQII
YSCNADPERGVKFNLIGESTIHCMSDREGNGIWSATPPRCELSASSVQCLPPTVSNGYQI
SAQGPPYFYNGTVAFRCYAGFTLKGSSQIRCSSSGTWDPEAPICEKETLSSACQPPPGIL
HGQHTGRSVGLLDPGTSVNYSCDLGYSLVGEATIHCTTEGVWKPVVPHCKETLSSACQPP
PGILHGQHTGRSVGLLDPGTSVNYSCDLGYSLVGEATIHCTTEGVWKPVVPHCKAILCSP
PPVIENGKYTGSSADEVPYGTQIIYSCNADPERGVKFNLIGESTIHCMSDREGNGIWSAT
PPRCELSASSVQCLPPTVSNGYQISAQGPPYFYNGTVAFRCYAGFTLKGSSQIRCSSSGT
WDPEAPICEKACQPPPGILHGQHTGRSVGLLDPGTSVNYSCDLGYSLVGEATIHCTAEGV
WKPVVPHCKGAWVVDLVLVLLLRFPSPDISISCYDGCPFLSTLKSIFRTEMPLCQPLLTC
QTILCSPPPVIENGKYTGSSADEVPYGTQIIYSCNADPERGVKFNLIGESTIHCMSDREG
NGIWSATPPRCELSASSVQCLPPTVSNGYQISAQGPPYFYNGTVAFRCYAGFTLKGSSQI
RCSSSGTWDPEAPICEKARGCFWCGEALLPPIVGLLDPGTSVNYSCDLGYSLVGEATIHC
TAEGVWKPVVPHCKAILCSPPPVIENGKYMGSSADEVPYGTQIIYSCNADPERGVKFNLI
GESTIHCMSDREGNGIWSATPPRCELSASSVQCLPPTVSNGYQISAQGPPYFYNGTVAFR
CYAGFTLKGSSQIRCSSSGTWDPEAPICEKETLSSACQPPPGILHGQHTGRSVGLLDPGT
SVNYSCDLGYSLVGEATIHCTTEGVWKPVVPHCK
Download sequence
Identical sequences H9H862
ENSMODP00000026983 ENSMODP00000008678 13616.ENSMODP00000026983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.