SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008749 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008749
Domain Number 1 Region: 161-258
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-35
Family Link domain 0.00058
Further Details:      
 
Domain Number 2 Region: 268-353
Classification Level Classification E-value
Superfamily C-type lectin-like 6.18e-26
Family Link domain 0.0026
Further Details:      
 
Domain Number 3 Region: 45-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000175
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008749   Gene: ENSMODG00000007055   Transcript: ENSMODT00000008922
Sequence length 379
Comment pep:novel chromosome:BROADO5:3:449478663:449507635:-1 gene:ENSMODG00000007055 transcript:ENSMODT00000008922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPFCQPVGIIIWILLVFAASALGGSDRGRKKIVHVLEDESGAVVVQTAPGKVVTHRGGT
IVLPCRYHYDISAHDEDEIRLKWTKVTDPLAFRDVFVAMGKERRAFGSYRGRTSLQEDGP
GDASLIIRNVTLQDYGRYECEVTNELEDDAGMVSLDLEGVIFPYHPRLGRYTLTYPEAQR
ACAEQDGILASYEQLHAAWREGLDWCNAGWLQDGSVQYPVGQPREECGRRESPVGVRNYG
YRHKEDERYDAFCFTSNLQSQVFFLKPYRKVSFPEAVRACAGSGAAVAKVGQLYAAWKLQ
LLDRCEAGWLGDGSVRYPIVNPRARCGGQRPGVRNLGFPDKKHRLFGVYCYRAPGSRDPG
AARWGWGWRDPSAWRPLHV
Download sequence
Identical sequences F6UF93
ENSMODP00000008749 ENSMODP00000008749 XP_007489262.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]