SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008762 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008762
Domain Number 1 Region: 21-116
Classification Level Classification E-value
Superfamily Immunoglobulin 5.52e-29
Family V set domains (antibody variable domain-like) 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008762   Gene: ENSMODG00000022694   Transcript: ENSMODT00000008935
Sequence length 122
Comment pep:novel chromosome:BROADO5:Un:53298384:53298877:-1 gene:ENSMODG00000022694 transcript:ENSMODT00000008935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPLVCLSLLTFCSGSLSQPVVTQPPSASASLGSSVSLSCTLSSELSARTVGWHQQSPG
KPPRYLLYVGGGGGTSRGDGIPERFSGSGSGTNRFLSISNVQPDDEADYYCQSDYYSGGS
YP
Download sequence
Identical sequences H9H694
ENSMODP00000008762 13616.ENSMODP00000008762 ENSMODP00000008762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]