SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008813 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008813
Domain Number 1 Region: 21-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-29
Family V set domains (antibody variable domain-like) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008813   Gene: ENSMODG00000023420   Transcript: ENSMODT00000008986
Sequence length 125
Comment pep:novel chromosome:BROADO5:3:524138189:524138934:1 gene:ENSMODG00000023420 transcript:ENSMODT00000008986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPLVCLSLLTFCSGSLSQPVLTQSPSVSASLGSSARLTCTLSSQHSSYYVDWYQQSPG
KPPLYLMRVKSDGSISRGDGIPERFSGSSSGADRFLSISNVQAEDEADYFCGADYRSGSS
YGYTQ
Download sequence
Identical sequences M9MMH3
ENSMODP00000008813 ENSMODP00000008813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]