SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008820 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008820
Domain Number 1 Region: 20-112
Classification Level Classification E-value
Superfamily Immunoglobulin 6.71e-31
Family V set domains (antibody variable domain-like) 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008820   Gene: ENSMODG00000007109   Transcript: ENSMODT00000008993
Sequence length 115
Comment pep:known chromosome:BROADO5:3:524112433:524112906:1 gene:ENSMODG00000007109 transcript:ENSMODT00000008993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWPLVCLSLLTFCSGSLSQSVVTQPPSASASLGSKVSLSCTLSSGSSHYPVHWHQQSPG
KPPRYLLYVDSDGDTGRGDGIPERFSGSGSGTNRFLSISNVEPEDEADYYCGGGY
Download sequence
Identical sequences F6SI59
13616.ENSMODP00000008820 ENSMODP00000008820 ENSMODP00000008820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]