SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008932 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008932
Domain Number 1 Region: 389-555
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.22e-27
Family Toll/Interleukin receptor TIR domain 0.00073
Further Details:      
 
Domain Number 2 Region: 246-343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000982
Family I set domains 0.032
Further Details:      
 
Domain Number 3 Region: 32-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000309
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 153-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000323
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008932   Gene: ENSMODG00000007199   Transcript: ENSMODT00000009107
Sequence length 690
Comment pep:novel chromosome:BROADO5:4:35342700:36497945:-1 gene:ENSMODG00000007199 transcript:ENSMODT00000009107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHLILIYETYTQSRKTVIRGVADGCTDWSVDIKKYQVLVGEPVRIKCALFYGYIRANYSL
AQSAGLSLMWYKSSGPGDFEEPIAFDGTRMSKEEDSIWFRPTLVQDSGLYACVIRNSTYC
MKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLTPYKEPEILWYKECR
TKTWRPSIIFKRNILLIREVREDDIGNYTCELKYGGFVVRRTTLFKILAPLTDKPPKLLY
PLESKLTIQETQLGNLANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRIL
KEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYTVELAGGLGA
ILLLLVCLVTIYKCYKIDIMLFYRNHFGAEEIDGDNKDYDAYLSYTKVDPDQWNQETGEE
ERFALEILPDMLEKHYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPNYVVRRG
WSIFELETRLRNMLVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWHGPKCNK
LNSKFWKRLQYEMPFKRIEPITHEQVLDVSEQGPFGELQTVSAISMAAATSTALATAHPD
LRSTFHNTYHSQMRQKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQRPQTKS
SREQNPDEAHTNSAILPLLPRETSISSVIW
Download sequence
Identical sequences F6WTG7
ENSMODP00000008932 13616.ENSMODP00000008932 ENSMODP00000008932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]