SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009193 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009193
Domain Number 1 Region: 117-213
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-23
Family I set domains 0.0034
Further Details:      
 
Domain Number 2 Region: 22-115
Classification Level Classification E-value
Superfamily Immunoglobulin 2e-21
Family I set domains 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009193   Gene: ENSMODG00000007409   Transcript: ENSMODT00000009374
Sequence length 307
Comment pep:novel chromosome:BROADO5:Un:76814143:76818925:1 gene:ENSMODG00000007409 transcript:ENSMODT00000009374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSSLPGLCLGQRMRTQAADKLPRPSLRAEDGSLVPQGRTVTLRCRGSQEADLYRLEQKQ
GYARSEIKGMTTVGIEVNFSLPFVTWNHAGTYYCHYRHSLGWSEPSEPLQLVVTGLYEEP
SLAALPSSEVASGQNVTLQCQTRGWHDWFVLYKDGEEITRGMTQSHGRGRHFEFYFHAVT
SSQNGTYRCYSFQSSFPNQWSSPSAPLVLRVSGEETPALPSLLSSLYDPEAPHWGSHISV
TNSYSPDCAALDYTMGNLVRLILAGLVLILLGVLLTENWKSSRDTLTRSSLKIEVKEGRN
EQSYLTI
Download sequence
Identical sequences H9H637
ENSMODP00000004820 ENSMODP00000009193 13616.ENSMODP00000004820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]