SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009253 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009253
Domain Number 1 Region: 307-473
Classification Level Classification E-value
Superfamily vWA-like 3.56e-23
Family Integrin A (or I) domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009253
Domain Number - Region: 750-811
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0434
Family Fibronectin type III 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009253   Gene: ENSMODG00000029157   Transcript: ENSMODT00000009434
Sequence length 912
Comment pep:novel chromosome:BROADO5:2:38298511:38360427:-1 gene:ENSMODG00000029157 transcript:ENSMODT00000009434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPFKMPILVLTLYLLQGTGASLIKLNGNGYEDVVIAIDPNVPEDEKLIQQIEDMISEAS
TYLYRATEKRFYFESVSILIPKTWQPKSDYEKPKHETYKNADIIIEVPNSPGNDIPRIDQ
FGKCGERGERIYLTPRIIRGEMLNVFGPKGKVLVHEWAHFRWGVFEEYNEDNPFYQFDGK
NVPVKCSEGITGTNKVYTCSGGSCSIRDCWTDPKTGKLNKDCMFIPDKVQSEKASIMFMQ
SIDSVVEFCTEKNHNRFAPNLQNKMCYLKSTWEVIQDSEDYKKSTPMMAAEPPKSRFSLK
QIGERILVLVIDTSRSMKVGNRLNRLRQASQFFLLQIIEKGSWTGVVTFDSSATIQSELI
QIESDVQRKTLISRLPTVTVAGGGAHICSGLRTAFMVVKKKFLTDGSEMALLTDGEDNTT
NTCFEEVKQSGAIIHTIVLGPSTEKGLEKLSEMTGGMKTTATDNVQNNGLIDAFSALSSG
NAAITQRSIKLESKGITLTNEGWMNGTVIFDSTVGKDTLFLVTWTAQQPEMFVTDPSGNI
YKNFAVETSSQMAYLQIPNTAQVGIWTYSLKSSAQTLTLTITSRAANPTVPPFTVDSRMH
KDTSSFPSPMIVYAEVRQGSLPILGANVTALIESADGTTVTLQLLDNGAGADSFKNDGVY
SRYFLGYKTDGQYSLKVRALGRTNTQRSRSQVNRAMYIPGSIDQAGQIQVNKPKPTLSPG
MPQTGFNVVSTGDSFLVSNDPSSQPSQTDIFPPCRIKDLKANFEEDHIRLTWTAPGDDFD
TGRADRYIIRMSKDLSTLSSYFDSALQVNTDNLIPKYANSEEVFVFKPKGLRIENGTVIY
LAIKAVDKANLMSPMSNIAQVYMFTSSLEDQNDSSPGTSISIIVLSVVGSLVAIAIIACV
IVYLLNKTRTQD
Download sequence
Identical sequences F7DB14
XP_007480625.1.35504 ENSMODP00000009253 ENSMODP00000009253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]