SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009257 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009257
Domain Number 1 Region: 26-212
Classification Level Classification E-value
Superfamily vWA-like 3.4e-51
Family Integrin A (or I) domain 0.00039
Further Details:      
 
Domain Number 2 Region: 626-815
Classification Level Classification E-value
Superfamily vWA-like 9.43e-48
Family Integrin A (or I) domain 0.00097
Further Details:      
 
Domain Number 3 Region: 1420-1610
Classification Level Classification E-value
Superfamily vWA-like 3.12e-45
Family Integrin A (or I) domain 0.00094
Further Details:      
 
Domain Number 4 Region: 227-418
Classification Level Classification E-value
Superfamily vWA-like 6.02e-45
Family Integrin A (or I) domain 0.0006
Further Details:      
 
Domain Number 5 Region: 1021-1203
Classification Level Classification E-value
Superfamily vWA-like 2.23e-44
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 6 Region: 1619-1814
Classification Level Classification E-value
Superfamily vWA-like 2.38e-43
Family Integrin A (or I) domain 0.00042
Further Details:      
 
Domain Number 7 Region: 422-601
Classification Level Classification E-value
Superfamily vWA-like 7.57e-43
Family Integrin A (or I) domain 0.0007
Further Details:      
 
Domain Number 8 Region: 834-1010
Classification Level Classification E-value
Superfamily vWA-like 5.42e-41
Family Integrin A (or I) domain 0.0011
Further Details:      
 
Domain Number 9 Region: 1230-1404
Classification Level Classification E-value
Superfamily vWA-like 2.23e-40
Family Integrin A (or I) domain 0.00045
Further Details:      
 
Domain Number 10 Region: 2608-2798
Classification Level Classification E-value
Superfamily vWA-like 1.75e-28
Family Integrin A (or I) domain 0.0018
Further Details:      
 
Domain Number 11 Region: 2389-2580
Classification Level Classification E-value
Superfamily vWA-like 1.04e-27
Family Integrin A (or I) domain 0.014
Further Details:      
 
Domain Number 12 Region: 3102-3158
Classification Level Classification E-value
Superfamily BPTI-like 5.25e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00085
Further Details:      
 
Domain Number 13 Region: 2987-3080
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000185
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 14 Region: 1935-2027
Classification Level Classification E-value
Superfamily vWA-like 0.00000188
Family Integrin A (or I) domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009257   Gene: ENSMODG00000007458   Transcript: ENSMODT00000009438
Sequence length 3170
Comment pep:novel chromosome:BROADO5:2:534678693:534859976:1 gene:ENSMODG00000007458 transcript:ENSMODT00000009438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKHRHLPLVAIFCLLVSGFGVTDAQEAVQTSAAADIIFLVDSSWSIGKEHFQLVREFLY
DVIESLAVAGSDFRFALVQFNGNPHTEFLLNTYRTNQEVLSHIANMTYLGGDSKTGRGLR
YVIQNHLTPAAGSRARDGVPQVIVVLTDGRSQDDVAGPSAELKSAAAVDVVAIGVQDAEE
GELKEMATEPLDLHVFNLENFTALHDIVGNLVACVRSSMVADIAGAPEIPKDITAQESAD
LIFLIDGSDKTGSAHFAAIRDFLVNFLERLPIGARQIQVGVVQYSNGPRTAFSLNSYSTK
ADVLDAVKALRVIGGEETNVGAALDFVVENHFTQAGGSRVEEGVPQVLVLISGSQSTDDI
RDGVVALKQASIFSFGLGAQGADRAELQHIATDENFVFTTPEFRSLGDLREYLLPYIVGV
AQRTIVLQPPTIVTQVIEVNKRDIVFLIDGTSTRGSANFNAIRDFLYKVVQKLEIGQDLI
QVAVAQYADTVKLGFHFKDFQSRRDVLSAIRRLRPINGTVLYTGAALDYVRNNFFNGSVG
YRASEGVPKLLVLITGGKSLDDISYPAQELKRSGIMAFAIGSPMADRTELEEVAFDPSLV
FEPAEFRPGPMQAILPGFLSPLRTLSGTTQVPVNKRDIIFLLDGSLNVGNANFPYVRDFV
MNLVNSLDVGYDNIRVGLVQFSDTPETEFSLDTYQSKSDLLARLRQLQLKGGSTLNIGSA
LDFVHSNHFTEAGGSRIHENIPQLLLLLAAGQSGDSYLQASNALARAGVLTFCVGASQAN
KAELEQIAFNPSLVYLMDDFSSLPALPQQLIQPLTTYVSGGVEEVPLAPTEGQRDILFLF
DGSANLIGQFPAVRDFLYKIIDELNVKPDGTRIAVAQYSDNVKVESRFSDHQSKTDLLNH
VKRMKIKGGKLLNVGQALDFAQRNLFVKSSGSRIEEGVPQFLVLLAAGRSTDRVDGPAQN
LRQVGIIPFIFQAKNADPAELERIVPSPAFILAAESLPKIGELQPQIVNLLKTVQNGGPS
PGPGERKDIVFLIDGSDRVRSDFPFLKDFVRKVVESLDVGPDRVRVAVVQFSERARPAFY
LNSYSDQRAVLQAVRQLSPLGGASLHTGSALDFVLRNVLVESAGSRMAEGVPQVLIVLSA
GRSQDDIQGPAVLLKRSGAVPFGIGIGHSDDAEMRTISYVPDFAAVIPTFQQLAHVQQLV
SEKVILLSQEELQKIRPALPLPPPGAGSKRDVVFLIDGSQNTVQEFSYIRALIESLIEEL
DVGFDTTRVAVIQFSEDPRVEFLLNAHSSKDDVQVAVRRLRPKGGRQINVGSALDYVSKN
IFRRPLGSRLEEGVPQFLVLISSGRSSDDVEDAAAHIKETGVAPFTVARNVDPEELVRIS
LSPEYVFSVSTFRELPSLEQKLLTPITTLTSEQIKSILSQTPHPRPDVEGNAADIVFLVD
SSDSVRPEGIVHIRDFIRNIVRKFDVGPNRIRIGLAQFSNEVFPEFYLRTHKSQSDVLEA
IRRLRFRGGSPLNTGKALEFVAKNFFVKSAGSRIEDGVPQHLVLFLGGKSQDDVSRAARV
MSSSGIIRVGVGSRNVDRTELETITGRDSRLIFTIREFRDLHNIESQVLSSFGPSGVTPT
PPGPFSPPTLVPKKADIVFLLDGSINFKRDNFQEVLRFVSGIVDTIYEGGDSIQVGLVQY
NSDPTDEFFLKDFSTKEEILDAINKVVYKGGRQANTLVGLEHLRKNHFVPEAGSRIDQRI
PQIAFVITGGSSVEDVEEATRALSQKGVKVFAVGVRNVDLREVSRIASNSAIAFRVSNVQ
ELSELSEQVLETLHDAMHETLCPGVPDVSRGTECRVGLVFPGSIVNPIDVAWLLASGAQS
SSLALLRGPHAKRRLPHPGGSSLGALGWDRGGGLSWLPSVWLPPASALGLTNASGATPGR
PGRALASPSRAVGAPSASRVVIHFTDGVDGDLAALHRASAELQEEGVKALIFVGLERAAN
YDNVMQLEFGRGFTYNRPLAVSLMDLDYELAEQLDSIAERACCGVPCKCSGQRGDRGPLG
SIGPKGMPGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGTKGSRGFPGEKGELG
EIGLDGLNGEEGDKGLPGSSGDRGSAGRRGDRGAKGEKGERGDMGIRGDPGEIGRDSQQR
GPKGEKGEIGPMGVPGRDGRSGGPGGVGKDGGPGRRGPPGGKGNKGGPGQPGISGESGAR
GPQGPPGPTGPPGLIGEQGIPGPRGGGGTPGVPGDRGRPGPLGAKGEPGDPGPKGGNGPR
GPRGEMGDDGRDGMGLVGQKGKKGERGFPGYPGPKGAPGDRGGDGGPGPKGSRGRRGNSG
PPGGVGQKGDPGYPGPSGHKGIRGESVDQCSLIQSIKDKCPCCYGPLECPVFPTELAFAL
DTSQGVSQDSFSRMRDVLLKIVGDLTIAESNCPRGARVAVVTYNNEVTTEIRFPDSKRKA
LLLDRIRNLQVPLTSKERSLETAMAFVARNTFKRARSGFLMRKVAVFFSNGLVRASPRLN
EAVLKLSDAGITPLFLTSREDRTLINALQINNTAVGHALVLPSGRNLNDFLKNVLTCHVC
LDICNPDQSCGFGSYRPAFRDRRAAGSDVDIDMAFILDSSETTTPFAFNEMRKYIAYTVK
QLDISPDPKMSQHLTRVAVLQHAPWEHEGNSSFPPVRVELSLTDYGSKDKLVDFLSNHMT
LLPGTRALGNAIEYTIESIFESAPNPRDLKIVVLMVTGEVKKAELDDLQRIIVQAKCKGY
FFVVLGIGRNVNVKDVYSFASEPNDVFFKLADKPTELNEEPLLRFARLLPSYVNSENAFY
LSPDIRKQCDWFQGDQPAKNPIKLGQRQIHVPNNATSVSTPKPVTTTKPTTSATLPSVKQ
NPVKTPAHPAPVKQDPANPISANSVPVKQVPENPVAAHPFPVKQAPADPAPAKPAPANPA
PVARPVASKAAAAKPVATKPVTPKPLATKPQATKPLSSKPAVKTSREVHVSEITENSARL
RWVNPDQPNPYIYDLTITSTHDRSVVLRQNLTVAERVIGGLVAGQTYHVAVVSYLKSQVK
ATYEGMFTTRKTQPPPPQPPRSASSATVNLMVNSEPWKGKEADICKMPQEIGTCGNFALR
WFYDPESQSCGRFWYSGCGDNGNNFATEADCEKACMHAHISPGVISTIGT
Download sequence
Identical sequences F7DAY0
ENSMODP00000009257 ENSMODP00000009257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]