SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009675 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009675
Domain Number 1 Region: 46-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000923
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009675   Gene: ENSMODG00000007789   Transcript: ENSMODT00000009866
Sequence length 243
Comment pep:novel chromosome:BROADO5:6:61830252:61839260:-1 gene:ENSMODG00000007789 transcript:ENSMODT00000009866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYNKMATPNRAVTIITLEFNLILLYTGAIQTCTVNIQQPSFLEVDYTCKTITIQCDFSVI
NCPKSNPKVLWFRQDAYHQPANLCPNQCLDKAGKFTITESLTQNQASLTLNTVTLNDSAI
YFCGIAFSESDEPRSKQTGPGTMLVVRGTRLLSHEVQNLLIALLSLLSIYIAALSVIFIV
ISKQLKLKMPRKTGTDEEPPKKRSARHVFQEIAQELYHKRYVETKQPEKDDIIYENRRAH
SNF
Download sequence
Identical sequences F7A990
ENSMODP00000009675 XP_007498312.1.35504 ENSMODP00000009675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]