SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009748 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009748
Domain Number 1 Region: 20-283
Classification Level Classification E-value
Superfamily L domain-like 1.75e-46
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 279-372
Classification Level Classification E-value
Superfamily Immunoglobulin 2.6e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 409-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000265
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009748   Gene: ENSMODG00000007842   Transcript: ENSMODT00000009939
Sequence length 637
Comment pep:novel chromosome:BROADO5:8:12473499:12478411:-1 gene:ENSMODG00000007842 transcript:ENSMODT00000009939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPLLLLLLASGALGCPLPCTCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFI
QALGPPDFRNMTGLVDLTLSRNAINRIGARSFGDLESLRSLHLDGNRLAELGAGSLRGPI
NLQHLILSSNQLGSIAAGAFDDFLESLEDLDLSYNNLRQVPWAGIGAMLVLHTLNLDHNL
IDALPPGAFAQLGQLSRLDLTSNRLATLAPDPIFSRGLDTAASPSPLVLSFGGNPLHCNC
ELLWLRRLARPDDLETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRALL
RCRALGDPAPTMHWVGPDDRLVGNSSRAQAFPNGTLEIGVTGAGDAGDYTCIATNAAGEA
TARVELRVLALPHGGNGSAGGARPGPSDIAASARTAAEGEGTQEAGPTVEVSEVTATSGL
VSWGPGRPEEPIWMFQIQYNSSEDETLIYRIIPSSSRHFLLKHLVPGADYDLCLLALSPA
AVPSDLTATRLLGCAHFSTLPAMPLCHALQAHVLGGTLTVAVGGVLVAALLVFTVALLVR
GRGAGAARLPLKLSHVHSQTNGGGPSPIPKPHPPRSPPPRPQRSCSLDLGETGGCYGYAR
RLGGAWTRRSHSVHGGLLGAACRGAGGSGERLEESVV
Download sequence
Identical sequences F7ETA6
ENSMODP00000009748 ENSMODP00000009748 XP_001364599.1.35504 13616.ENSMODP00000009748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]