SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009809 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009809
Domain Number 1 Region: 75-166
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000429
Family Fibronectin type III 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009809   Gene: ENSMODG00000007887   Transcript: ENSMODT00000010001
Sequence length 243
Comment pep:novel chromosome:BROADO5:5:300507917:300508648:-1 gene:ENSMODG00000007887 transcript:ENSMODT00000010001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSTCFLKFLTVVLFLPCLAWSLSSDDYEEEEGEEGEKTPPPELGFCDYDHCRHLQVPC
KELQGLNGSACLCPGTSSPSQPPDPPRLGEVRIWPEEGRAAVHWCAPASPVDEYWLELWE
GGDPGRTGPRVLFNNTVRRAELEGLKPGRTYILCVVASNDAGASPVPEGGGEDFDADGTP
LFGPCRHLSVPLRLRTLVHIAVGIGMVLISISSAVLLWHFCPWKRWGHQQPRGAAAFRAG
EEL
Download sequence
Identical sequences F6ZGZ8
ENSMODP00000009809 ENSMODP00000009809 13616.ENSMODP00000009809 XP_007497774.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]