SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009933 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009933
Domain Number 1 Region: 104-201
Classification Level Classification E-value
Superfamily Fibronectin type III 6.57e-24
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 2 Region: 199-300
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-20
Family Fibronectin type III 0.00000411
Further Details:      
 
Domain Number 3 Region: 31-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000011
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009933   Gene: ENSMODG00000007977   Transcript: ENSMODT00000010125
Sequence length 368
Comment pep:novel chromosome:BROADO5:6:124323695:124375395:1 gene:ENSMODG00000007977 transcript:ENSMODT00000010125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPVLWACFVVLAAGVVVYAQRHSQQDTHVLYERLGSDVTLPCGTAAWDTAVTWRVNGT
DLEAAHLNGSQLVLEGLDLSHSGHYACYQGSSWHLHYQALLHVGMPPREPVLNCRSNSYP
KGFYCSWHLPTPTYIPNTFNVTVLHGSKLLGCEKDPAPKNRCHIRYTHLFSTVKYKVTLT
VTNALGHNSTAITFDEFTIVKPDPPENVVARPVPSSPRRLEVTWQTPSSWPDPESFPLKF
FLRYRPLILDQWQHVELSDGTTHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPW
TEEPRYLTTEAQAPETTTTMTTSFVPPPTTKICDSGEVGDGVGSSTSLLLTVTVTVTVTT
IAASGFFI
Download sequence
Identical sequences F7D6B6
ENSMODP00000009933 13616.ENSMODP00000009933 ENSMODP00000009933 XP_007498920.1.35504 XP_007498921.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]