SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009937 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009937
Domain Number 1 Region: 307-472
Classification Level Classification E-value
Superfamily vWA-like 1.54e-25
Family Integrin A (or I) domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009937
Domain Number - Region: 739-788
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0689
Family Fibronectin type III 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009937   Gene: ENSMODG00000007979   Transcript: ENSMODT00000010129
Sequence length 911
Comment pep:novel chromosome:BROADO5:2:38476414:38542985:1 gene:ENSMODG00000007979 transcript:ENSMODT00000010129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSFKMLVLILTLFLLGGAGASLIKLNGNGYEDVVIAIDPNVPEDEKLIQHIQDMVTEAS
TYLYGATEKRFYFKAVSILIPETWQKKNEYEEPKLETYKKADIVIEVPNPPGFDVPRTDQ
FGQCGDKGERIRLTPAIVLGEKLNEYGPQGKILVHEWAHLRWGVFEEYNEEEPFYQHDGR
NVPVKCSDGITGTNKVYACSGGSCSIRNCRTDPKTGKLNKDCMFIPDKVQSEKASIMFMQ
SIDSVVEFCTEKNHNTLAPNPQNKMCNSRSTWEVIQNSEDYKNSIPMTEAKPPHPIFSLK
QIRERVLILVLDKSGSMAGEDRLNRLNQASQLFLLQIIEKGSWTGMVTFDSSATIQSALI
QIETDAQRNSLISRLPTAAGGGTSICSGLRTAFTVIKKKFSTHGSEIVLLTDGEDSTISS
CFDEVKQSGAIIHTVALGPSADPGLEKLAEMTGGMKTSATDNAQNNGLIDAFSALSSGNG
AITQRSIQLESKGVTLTNEDWMNGTVIFDSTVGNDTLFLVTWTAQQPEMFVMDPSGNIYK
NFAVQTSSKMAYLPIPNTAQVGIWTYSLKSSAQTLTLTVTSRAANPTVSPITVDSRMNKD
TSRFPSPMIVYAEVRQGSLPIIGANVTALIESADGTVTLELLDNGAGADVFKNDGVYSRY
FTAYKKNGRYSLKVRALGGTNTQRSRPKVNGAFYIPGWVENGEIKMNPPKPEISEDENQA
NMQSFSRTSSGGSFIVSNIPPTVPDVFPPNRIIDLEANVEDDHINLTWTAPGDDFDTGRA
EEYIIKMSKDILTLRENFDAALQVNTTDLIPNDANAKEDFMFKPDFLIENGTTVFLAIKA
VDKANLTSPISNIAQASLIIPSAEDPFSPSPEDPFSPSGTSISTIVLSVVGTVAAVAIIV
SVTVCVMKKKR
Download sequence
Identical sequences F7D697
ENSMODP00000009937 ENSMODP00000009937 XP_001362488.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]