SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010004 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010004
Domain Number 1 Region: 83-206
Classification Level Classification E-value
Superfamily Fibronectin type III 7.26e-36
Family Fibronectin type III 0.00000546
Further Details:      
 
Domain Number 2 Region: 207-305
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000125
Family Fibronectin type III 0.0000646
Further Details:      
 
Domain Number 3 Region: 14-74
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000304
Family I set domains 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010004   Gene: ENSMODG00000008039   Transcript: ENSMODT00000010196
Sequence length 308
Comment pep:novel chromosome:BROADO5:1:354721228:354728182:-1 gene:ENSMODG00000008039 transcript:ENSMODT00000010196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVYVVEVDLNLDAPAETVVLTCDSSEEDNTITWTSNENDQILGSGKTLTIQVREFTEAGN
YICQKGGEVLSHKLLLIRVTEYGIWSTDILKEQKESQSKSYLKCEAKNYAGTFTCCWLKS
TLSLKTAMVTTKLSSNPRGVTCGPIVLAEEKVKQDNKEYRKYTADCQETSACPSAEESHP
IEVVLDAIQKHKYEKYTSSFFIRDIIKPDPPRKLHITPLNTKTVKVSWDYPETWSTPHSY
FPLNFKVQVHGKNKKVKNQQVVLLCFIQNSFITEATSAECPKGKTISVRAKDRYYNSFWS
KSASVSCE
Download sequence
Identical sequences F6ZAJ3
ENSMODP00000010004 ENSMODP00000010004 13616.ENSMODP00000010004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]