SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010050 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010050
Domain Number 1 Region: 415-611
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-38
Family Fibronectin type III 0.00047
Further Details:      
 
Domain Number 2 Region: 719-912
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-36
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 3 Region: 318-411
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-22
Family I set domains 0.0051
Further Details:      
 
Domain Number 4 Region: 232-329
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-18
Family I set domains 0.029
Further Details:      
 
Domain Number 5 Region: 39-129
Classification Level Classification E-value
Superfamily Immunoglobulin 9.62e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 6 Region: 135-223
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 7 Region: 615-702
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000169
Family Fibronectin type III 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010050   Gene: ENSMODG00000008078   Transcript: ENSMODT00000010243
Sequence length 986
Comment pep:novel chromosome:BROADO5:1:165761703:165888573:1 gene:ENSMODG00000008078 transcript:ENSMODT00000010243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSPRPLTRLRPPGMLLRAVLFLLISGPGVWCFSELFFIKEPQDVTVTRKDPVVLDCQA
HGELPIKITWLKNGAKVSENKRIHALSNGSLYISEVEGKRGELSDEGLYQCLALNKYGAI
LSQKAHLTLATISAFEVQPVSIEVQEGGVARLACKITSHPPAIITWELNRTSLPLAMDRI
TALPTGVLQIYGVGQKDAGNYRCVATTIASRRKSIEATVTVIPAKESKSFHKPTIIAGPQ
NITTSLHQTIVLECMATGNPKPIISWSRLDHKSIDVFNTRVLGNGNLMISDVKLQHAGIY
ICRATTPGTRNFTVSMATLTVLAPPSFVEWPESLTRPRAGTARFVCQAEGIPSPKMSWLK
NGRRIHSNGRIKMYNSKLVINQIIPEDDAIYQCMAENSQGSILSRARLTVVMSEDRPGAP
CNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQVVIGNDTTHYIIDD
LEPASNYTFYIVAYMPMGASQMSDHVTQNTLEDVPLRPPEISLTSRSPTDILISWLPIPA
KYRRGQVVLYRVSFRISTENAVQVLELPGTIHEYLLEGLKPDSVYLVRITAATRVGLGEA
SVWTSHRTPKATSVKAPKSPELRLEPLNCTTITVRWQQDSEDTATVQGYKLYYKEEGQQE
NGPVLLDASDLLHTISGLDPRRKYHVRLLAYNNMEDGYQADQTVSTPGCVSVRDRMVPPP
PPPHHLYAKANTSSSIYLNWGRPAFTSAQIINYTIRCNPVGLQNASLVQYLQTSETHMLV
QSLEPNTKYEFAVRLHVDQLSSPWSPVVYHSTLPEAPAGPPVGVKVTLIEDDTALVSWKP
PDGPETVVTRYTILYASRKAWIAGEWQVLYREGAITMALLENLVAGNVYIVKIAASNEVG
EGPFSNSVELAVLPKETSESNQRPKRLDSTDAKAYSGYYQLDQKSMTGIVVGVCIALTCI
LICILILIYRSKARKTSASKTFTDRN
Download sequence
Identical sequences F6YJ94
ENSMODP00000010050 ENSMODP00000010050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]