SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010096 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010096
Domain Number 1 Region: 256-338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-17
Family SPRY domain 0.0012
Further Details:      
 
Domain Number 2 Region: 9-72
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000204
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 94-140
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000137
Family B-box zinc-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010096   Gene: ENSMODG00000008122   Transcript: ENSMODT00000010291
Sequence length 338
Comment pep:novel chromosome:BROADO5:6:125223928:125225027:1 gene:ENSMODG00000008122 transcript:ENSMODT00000010291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKQRNMPSCPDLIEDFQEELIYYICKEYFTNPMSTECGHHFCCACLFRSCQEASIPFSCP
WNVSQPRDFQTTRILGNWRPLPRNKEIIVCRTLKDKSFCEYDQSPICVSCCQCQEHKAHK
FYGTDKAAENFSGEPQETVTGLWRETLNIVQQMTNEKIKSALMEEEMEIQNKHILSEFQK
IEQFLNEERDACLSHIQTEGRANLEGPTKGISELSHHNVNLLQDMKGMFNRNESVLQKEI
ETFHVNITILPIPRIIEKIFSFKVDITLDCSTADLGLISEDLKSVRYGGVQEEVTDNNGK
FTAFAQVLGIQSFITRRCYWEVELPDNTAWYIDLCQKS
Download sequence
Identical sequences F7FV25
ENSMODP00000010096 ENSMODP00000010096 13616.ENSMODP00000010096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]