SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010236 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010236
Domain Number 1 Region: 153-352
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.7e-54
Family Prokaryotic proteases 0.00000053
Further Details:      
 
Domain Number 2 Region: 365-460
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-19
Family HtrA-like serine proteases 0.0015
Further Details:      
 
Domain Number 3 Region: 27-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000188
Family Growth factor receptor domain 0.0018
Further Details:      
 
Domain Number 4 Region: 91-136
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000217
Family Ovomucoid domain III-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010236   Gene: ENSMODG00000003113   Transcript: ENSMODT00000010434
Sequence length 463
Comment pep:novel chromosome:BROADO5:5:227198110:227248035:1 gene:ENSMODG00000003113 transcript:ENSMODT00000010434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSTFLLCALGLLALLNPCQAEPLACPPRCDVSKCPSPSCPGGYVPDRCNCCLVCAAAE
GDACGRKDDPPCGDSLECGHPAGKRFAKGVCQCKLTYQVCGSDGRTYDNVCRLKAASRKA
LQQGLPAVIQIQKGACESGHQQFTSPRYKFNFIADVVEKIAPAVVHIELFLRHPLFGRNV
PLSSGSGFIISESGLIVTNAHVVSSTNAISGRQQLKVQLQSGDTYEAMIKDIDKKSDIAT
IKINPKKKLPVLLLGHSTDLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGKELGLKDSD
MDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITRFLTESYDKQNK
DVKKRFIGIRMRTITPVLVEELKDNNPDFPDVSSGIYVHEVVPNSPSQRGGIKDGDIIVK
VNGRPLKNSSELQEAVMKESPLLLEVRRGNDDLLFNIEPEVVM
Download sequence
Identical sequences F6ZXS4
XP_001372613.1.35504 ENSMODP00000010236 ENSMODP00000010236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]