SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010602 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010602
Domain Number 1 Region: 489-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-81
Family Protein kinases, catalytic subunit 0.0000000000413
Further Details:      
 
Domain Number 2 Region: 274-377
Classification Level Classification E-value
Superfamily Immunoglobulin 7.78e-21
Family I set domains 0.0000026
Further Details:      
 
Domain Number 3 Region: 185-268
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-19
Family I set domains 0.0000109
Further Details:      
 
Domain Number 4 Region: 64-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000135
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010602   Gene: ENSMODG00000008525   Transcript: ENSMODT00000010809
Sequence length 839
Comment pep:novel chromosome:BROADO5:1:86664719:86788014:1 gene:ENSMODG00000008525 transcript:ENSMODT00000010809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLMSTWNYGKGPGIGTVKMVSWGRFMCLVLVTMATFSLARPSFNLVEETTLEPEEPPTK
YQISQPDVYAVLPGEPLELRCSLKDAIMISWTKDGVQLGPNNRTVLFGEYLQIKGAIPRD
SGLYACTAARTVDSETLYFMVNVTDAIASGDDEDDNEGSEDFVSDNNNMRAPYWTHTEKM
EKRLHAVPAANTVKFRCPAGGNPIPSMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVV
PSDKGNYTCIVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYS
DAQPHIQWIKHVERNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTC
LAGNSIGISFHSAWLTVLPAPVREKEFPASPEYLEIAIYCIGVFLIACMVVTVILCRMKT
TTKKPDFSSQPAVHKLTKRIPLRRQVTVSADSSSSMNSNTPLVRITTRLSSTADAPMLAG
VSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDD
ATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPP
GMEYSFDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKI
ADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGS
PYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILT
LTTNEEYLDLSGPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPKYQHINGTVKT
Download sequence
Identical sequences F7DHF8
ENSMODP00000010602 ENSMODP00000010602 XP_007478957.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]