SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010615 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010615
Domain Number 1 Region: 23-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000193
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010615   Gene: ENSMODG00000008537   Transcript: ENSMODT00000010822
Sequence length 370
Comment pep:novel chromosome:BROADO5:1:351857109:351886908:-1 gene:ENSMODG00000008537 transcript:ENSMODT00000010822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGVLLLWMVFELCLSKCSEATSQTVTGFLGHSVKLPCSYSVSAKNTRVMCWGKGFCPN
SKCSGEIVRTDGNRVTWSKSSKYQLQGNIGRGDVTLTIQNTNELDTGTYCCRIEVPGWFN
DIKKNIVLLLEKAPTTTRPTTTTRPTTTTRPTTTTLPTTTTLPTTTTLLTTTTLPTTTTL
PTTTIHLTTTTRSTTTTRSTTTTLTTTTRPTTTPLPSTTTHLVTTLLPASTTLLPTTTPL
HATNPHPVTTTHLTRVPLTATTPYLATTICPTTTATTTLQRTTSAISNLTMTHQLSTVKT
WGDPELLVITVPLVGFVILLMLLAFILRGKIMRKNYSDIHKRLNNAEVSSARSTLALPNG
MEEEDGFFTL
Download sequence
Identical sequences F7DHA5
ENSMODP00000010615 ENSMODP00000010615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]