SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010622 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000010622
Domain Number - Region: 87-123
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0189
Family Fibronectin type III 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010622   Gene: ENSMODG00000008542   Transcript: ENSMODT00000010829
Sequence length 263
Comment pep:novel chromosome:BROADO5:7:253258123:253261943:-1 gene:ENSMODG00000008542 transcript:ENSMODT00000010829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKFRPWKLRCPAIHLPSLTLFSLWKRAEPTTSSKGDMCKSLTTAEWKKIFYEKMEEAKP
ADSWDLIMDPNLQHNVLAPGWKQYLEQHASGRFHCSWCWHSWQSSHVVILFHMFLDPTQR
MGCVRMRVFKQLCYECGTARLDESSMLEENIEGLVDNLIISLREQCYGERGGQYRIHVAG
RQDNRRHRGESCEACLAGINHWKPSEKLLEEEATTYTFSRPASPSKAPEGGQGCNFCSLP
WCLFWATVLLLIIYLQFSFRSSA
Download sequence
Identical sequences F7DH23
ENSMODP00000010622 13616.ENSMODP00000010622 XP_001366241.1.35504 ENSMODP00000010622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]