SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010949 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010949
Domain Number 1 Region: 56-141
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000137
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010949   Gene: ENSMODG00000008802   Transcript: ENSMODT00000011165
Sequence length 359
Comment pep:novel chromosome:BROADO5:1:348184966:348194283:1 gene:ENSMODG00000008802 transcript:ENSMODT00000011165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPHYCLFTLVVYAVIPTAFFLNDVEYNRTIAVEANHTAYNGSFHPTFETLSNTHTSGNF
VIAKEGTSVLIQCLLTTSHYEDILWYNSKGPLPDPERGGGKWLIFRNYLNITNVTFDDRG
LYTCLVTSPVHDSYSVTLRVIFTSGDMSIYYMIVCLIAFTITLILNITRLCMMSSHLRKT
EKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVP
LPPLILNCRAFVEEMFEAVRVDDPDDMGERIKERPALSAQDGIYVITSDIGRSNSPEGDS
EDGSLNEQGQEIAVQVSVHLQSETQSIGTDSQNSCHSNPSEEVGSPELNSNCKDGASES
Download sequence
Identical sequences F6QVD5
ENSMODP00000010949 ENSMODP00000010949 XP_007473982.1.35504 XP_007473983.1.35504 13616.ENSMODP00000010949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]