SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011067 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011067
Domain Number 1 Region: 21-153
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.25e-38
Family Eukaryotic proteases 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011067   Gene: ENSMODG00000008883   Transcript: ENSMODT00000011284
Sequence length 154
Comment pep:novel chromosome:BROADO5:1:587154864:587160373:-1 gene:ENSMODG00000008883 transcript:ENSMODT00000011284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PWFFPSLPAPCGQVAVTQTLKNEAEPILGGVNMTNLEVPWHVTIHFKKSYLCGGTILDKW
WILTASHCFRNDNASGFKVHLATTDIHSQQVEKRTVKMIILHPNFNQLFMDNDIALLLLN
DPIEFGTDKIPICVTKDIKNMKECWVSGWGSSSE
Download sequence
Identical sequences F7CA90
ENSMODP00000011067 ENSMODP00000011067 13616.ENSMODP00000011067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]